HSPE1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HSPE1 full-length ORF ( AAH23518, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HSPE1
Entrez GeneID
3336GeneBank Accession#
BC023518Protein Accession#
AAH23518Gene Name
HSPE1
Gene Alias
CPN10, GROES, HSP10
Gene Description
heat shock 10kDa protein 1 (chaperonin 10)
Omim ID
600141Gene Ontology
HyperlinkGene Summary
This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. [provided by RefSeq
Other Designations
chaperonin 10|heat shock 10kD protein 1 (chaperonin 10)|heat shock 10kDa protein 1
-
Interactome
-
Disease
-
Publication Reference
-
Identification of the molecular chaperone, heat shock protein 1 (Chaperonin 10), in the reproductive tract and in capacitating spermatozoa in the male mouse.
Walsh A, Whelan D, Bielanowicz A, Skinner B, Aitken RJ, O'Bryan MK, Nixon B.
Biology of Reproduction 2008 Feb; 78(6):983.
Application:Func, Mouse, Mouse oocytes.
-
Identification of the molecular chaperone, heat shock protein 1 (Chaperonin 10), in the reproductive tract and in capacitating spermatozoa in the male mouse.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com