HSPE1 monoclonal antibody (M01), clone 4C11-B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HSPE1 monoclonal antibody (M01), clone 4C11-B11 Western Blot analysis of HSPE1 expression in COLO 320 HSR ( Cat # L020V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of HSPE1 expression in transfected 293T cell line by HSPE1 monoclonal antibody (M01), clone 4C11-B11.
Lane 1: HSPE1 transfected lysate(10.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSPE1 is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to HSPE1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.96 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HSPE1.
Immunogen
HSPE1 (AAH23518, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HSPE1 monoclonal antibody (M01), clone 4C11-B11 Western Blot analysis of HSPE1 expression in COLO 320 HSR ( Cat # L020V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HSPE1 expression in transfected 293T cell line by HSPE1 monoclonal antibody (M01), clone 4C11-B11.
Lane 1: HSPE1 transfected lysate(10.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSPE1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HSPE1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HSPE1
Entrez GeneID
3336GeneBank Accession#
BC023518Protein Accession#
AAH23518Gene Name
HSPE1
Gene Alias
CPN10, GROES, HSP10
Gene Description
heat shock 10kDa protein 1 (chaperonin 10)
Omim ID
600141Gene Ontology
HyperlinkGene Summary
This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. [provided by RefSeq
Other Designations
chaperonin 10|heat shock 10kD protein 1 (chaperonin 10)|heat shock 10kDa protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com