Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPB1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003315-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSPB1 partial ORF ( NP_001531, 96 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003315-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3315
  • Gene Name:
  • HSPB1
  • Gene Alias:
  • CMT2F,DKFZp586P1322,HMN2B,HS.76067,HSP27,HSP28,Hsp25,SRP27
  • Gene Description:
  • heat shock 27kDa protein 1
  • Gene Summary:
  • The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024846,estrogen-regulated 24 kDa protein,heat shock 27kD protein 1,heat shock protein beta-1,stress-responsive protein 27
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook