Product Browser

Last updated: 2017/5/21
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Disease

  • By Biomarker

  • By Hot Target

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00003315-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human HSPB1 protein.
  • Immunogen:
  • HSPB1 (NP_001531.1, 1 a.a. ~ 205 a.a) full-length human protein.
  • Sequence:
  • MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HSPB1 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPB1 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HSPB1 expression in transfected 293T cell line (H00003315-T01) by HSPB1 MaxPab polyclonal antibody.

    Lane 1: HSPB1 transfected lysate(22.80 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between HSPB1 and EGFR. HeLa cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-EGFR mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between HSPB1 and F13A1. Huh7 cells were stained with anti-HSPB1 rabbit purified polyclonal 1:1200 and anti-F13A1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3315
  • Gene Name:
  • HSPB1
  • Gene Alias:
  • CMT2F,DKFZp586P1322,HMN2B,HS.76067,HSP27,HSP28,Hsp25,SRP27
  • Gene Description:
  • heat shock 27kDa protein 1
  • Gene Summary:
  • The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024846,estrogen-regulated 24 kDa protein,heat shock 27kD protein 1,heat shock protein beta-1,stress-responsive protein 27
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook