Product Browser

Last updated: 2017/7/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPB1 polyclonal antibody (A01)

  • Catalog # : H00003315-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HSPB1.
  • Immunogen:
  • HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003315-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3315
  • Gene Name:
  • HSPB1
  • Gene Alias:
  • CMT2F,DKFZp586P1322,HMN2B,HS.76067,HSP27,HSP28,Hsp25,SRP27
  • Gene Description:
  • heat shock 27kDa protein 1
  • Gene Summary:
  • The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024846,estrogen-regulated 24 kDa protein,heat shock 27kD protein 1,heat shock protein beta-1,stress-responsive protein 27
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook