HSPA5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HSPA5 partial ORF ( AAH20235.1, 269 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.2
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HSPA5
Entrez GeneID
3309GeneBank Accession#
BC020235Protein Accession#
AAH20235.1Gene Name
HSPA5
Gene Alias
BIP, FLJ26106, GRP78, MIF2
Gene Description
heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
Omim ID
138120Gene Ontology
HyperlinkGene Summary
When Chinese hamster K12 cells are starved of glucose, the synthesis of several proteins, called glucose-regulated proteins (GRPs), is markedly increased. Hendershot et al. (1994) [PubMed 8020977] pointed out that one of these, GRP78 (HSPA5), also referred to as 'immunoglobulin heavy chain-binding protein' (BiP), is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum (ER). Because so many ER proteins interact transiently with GRP78, it may play a key role in monitoring protein transport through the cell.[supplied by OMIM
Other Designations
Heat-shock 70kD protein-5 (glucose-regulated protein, 78kD)|OTTHUMP00000022124|heat shock 70kD protein 5 (glucose-regulated protein, 78kD)|heat shock 70kDa protein 5
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com