Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPA1L (Human) Recombinant Protein (Q01)

  • Catalog # : H00003305-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSPA1L partial ORF ( NP_005518, 561 a.a. - 641 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.65
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003305-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3305
  • Gene Name:
  • HSPA1L
  • Gene Alias:
  • HSP70-1L,HSP70-HOM,HSP70T,hum70t
  • Gene Description:
  • heat shock 70kDa protein 1-like
  • Gene Summary:
  • This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029295,heat shock 10kDa protein 1-like,heat shock 70kD protein-like 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook