Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPA1L polyclonal antibody (A01)

  • Catalog # : H00003305-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HSPA1L.
  • Immunogen:
  • HSPA1L (NP_005518, 561 a.a. ~ 641 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003305-A01
    Western Blot detection against Immunogen (35.02 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HSPA1L polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of HSPA1L expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3305
  • Gene Name:
  • HSPA1L
  • Gene Alias:
  • HSP70-1L,HSP70-HOM,HSP70T,hum70t
  • Gene Description:
  • heat shock 70kDa protein 1-like
  • Gene Summary:
  • This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029295,heat shock 10kDa protein 1-like,heat shock 70kD protein-like 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook