HSF2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HSF2 full-length ORF ( AAH05329, 1 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.04
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HSF2
Entrez GeneID
3298GeneBank Accession#
BC005329Protein Accession#
AAH05329Gene Name
HSF2
Gene Alias
MGC117376, MGC156196, MGC75048
Gene Description
heat shock transcription factor 2
Omim ID
140581Gene Ontology
HyperlinkGene Summary
HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. [provided by RefSeq
Other Designations
OTTHUMP00000017845|heat shock factor 2
-
Interactome
-
Disease
-
Publication Reference
-
Alcohol Regulates Gene Expression in Neurons via Activation of Heat Shock Factor 1.
Pignataro L, Miller AN, Ma L, Midha S, Protiva P, Herrera DG, Harrison NL.
Journal of Neuroscience 2007 Nov; 27(47):12957.
Application:Func, Mouse, Mouse cortical neurons.
-
Alcohol Regulates Gene Expression in Neurons via Activation of Heat Shock Factor 1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com