HSD17B2 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HSD17B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver.
Western Blot (Tissue lysate)
HSD17B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in mouse kidney.
Western Blot (Transfected lysate)
Western Blot analysis of HSD17B2 expression in transfected 293T cell line (H00003294-T03) by HSD17B2 MaxPab polyclonal antibody.
Lane 1: HSD17B2 transfected lysate(42.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HSD17B2 transfected lysate using anti-HSD17B2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HSD17B2 purified MaxPab mouse polyclonal antibody (B02P) (H00003294-B02P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HSD17B2 protein.
Immunogen
HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein.
Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (61)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSD17B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver.Western Blot (Tissue lysate)
HSD17B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of HSD17B2 expression in transfected 293T cell line (H00003294-T03) by HSD17B2 MaxPab polyclonal antibody.
Lane 1: HSD17B2 transfected lysate(42.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HSD17B2 transfected lysate using anti-HSD17B2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with HSD17B2 purified MaxPab mouse polyclonal antibody (B02P) (H00003294-B02P). -
Gene Info — HSD17B2
Entrez GeneID
3294GeneBank Accession#
NM_002153.1Protein Accession#
NP_002144.1Gene Name
HSD17B2
Gene Alias
EDH17B2, HSD17, SDR9C2
Gene Description
hydroxysteroid (17-beta) dehydrogenase 2
Omim ID
109685Gene Ontology
HyperlinkGene Summary
member 2
Other Designations
short chain dehydrogenase/reductase family 9C, member 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com