HSD17B3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HSD17B3.
Immunogen
HSD17B3 (NP_000188, 29 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Sequence
RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.12 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — HSD17B3
Entrez GeneID
3293GeneBank Accession#
NM_000197Protein Accession#
NP_000188Gene Name
HSD17B3
Gene Alias
EDH17B3, SDR12C2
Gene Description
hydroxysteroid (17-beta) dehydrogenase 3
Gene Ontology
HyperlinkGene Summary
This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq
Other Designations
17-beta-HSD3|OTTHUMP00000021718|estradiol 17 beta-dehydrogenase 3|short chain dehydrogenase/reductase family 12C, member 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.
Fokidis HB, Yieng Chin M, Ho VW, Adomat HH, Soma KK, Fazli L, Nip KM, Cox M, Krystal G, Zoubeidi A, Tomlinson Guns ES.
The Journal of Steroid Biochemistry and Molecular Biology 2015 Jun; 150:35.
Application:WB, Mouse, LNCaP tumor.
-
Pomegranate extracts impact the androgen biosynthesis pathways in prostate cancer models in vitro and in vivo.
Ming DS, Pham S, Deb S, Chin MY, Kharmate G, Adomat H, Beheshti EH, Locke J, Guns ET.
The Journal of Steroid Biochemistry and Molecular Biology 2014 Sep; 143:19.
Application:WB-Ce, Human, LNCaP, 22RV1 cells.
-
Androgen Levels Increase by Intratumoral De novo Steroidogenesis during Progression of Castration-Resistant Prostate Cancer.
Locke JA, Guns ES, Lubik AA, Adomat HH, Hendy SC, Wood CA, Ettinger SL, Gleave ME, Nelson CC.
Cancer Research 2008 Aug; 68(15):6407.
Application:WB, Human, LNCaP xenograft tumors.
-
A low carbohydrate, high protein diet suppresses intratumoral androgen synthesis and slows castration-resistant prostate tumor growth in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com