Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B3 polyclonal antibody (A01)

  • Catalog # : H00003293-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HSD17B3.
  • Immunogen:
  • HSD17B3 (NP_000188, 29 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003293-A01
    Western Blot detection against Immunogen (36.12 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3293
  • Gene Name:
  • HSD17B3
  • Gene Alias:
  • EDH17B3,SDR12C2
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 3
  • Gene Summary:
  • This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq
  • Other Designations:
  • 17-beta-HSD3,OTTHUMP00000021718,estradiol 17 beta-dehydrogenase 3,short chain dehydrogenase/reductase family 12C, member 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook