HSD17B1 monoclonal antibody (M03), clone 2E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSD17B1.
Immunogen
HSD17B1 (NP_000404, 189 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (61); Rat (61)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HSD17B1 monoclonal antibody (M03), clone 2E5 Western Blot analysis of HSD17B1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HSD17B1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSD17B1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — HSD17B1
Entrez GeneID
3292GeneBank Accession#
NM_000413Protein Accession#
NP_000404Gene Name
HSD17B1
Gene Alias
EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Gene Description
hydroxysteroid (17-beta) dehydrogenase 1
Omim ID
109684Gene Ontology
HyperlinkGene Summary
member 1
Other Designations
Estradiol 17-beta-dehydrogenase-1|hydroxysteroid (17-beta) dehydrogenase 1 isoform|short chain dehydrogenase/reductase family 28CE, member 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Post-menopausal ovarian fibroma associated with steroid hormone synthesis: A case report.
Naomi Sato, Yuko Itakura, Yuji Yoshida, Junichi Akahira, Fumiyoshi Fujishima, Yasuhiro Nakamura.
Taiwanese Journal of Obstetrics & Gynecology 2023 Jul; 62(4):566.
Application:IHC-P, Human, Ovarian tumor.
-
Steroidogenesis in ovarian-like mesenchymal stroma of hepatic and pancreatic mucinous cystic neoplasms.
Kumata H, Murakami K, Ishida K, Miyagi S, Arakawa A, Inayama Y, Kinowaki K, Ochiai A, Kojima M, Higashi M, Moritani S, Kuwahara K, Nakatani Y, Kajiura D, Tamura G, Kijima H, Yamakawa M, Shiraishi T, Inadome Y, Murakami K, Suzuki H, Sawai T, Unno M, Kamei T, Sasano H.
Hepatology Research 2018 Jun; [Epub].
Application:IHC-P, Human, Human ovaries.
-
The presence and impact of estrogen metabolism on the biology of triple-negative breast cancer.
McNamara KM, Oguro S, Omata F, Kikuchi K, Guestini F, Suzuki K, Yang Y, Abe E, Hirakawa H, Brown KA, Takanori I, Ohuchi N, Sasano H.
Breast Cancer Res Treat 2017 Jan; 161(2):213.
Application:IHC, Human, Triple-negative breast cancer (TNBC).
-
The role of estrogen-metabolizing enzymes and estrogen receptors in human epidermis.
Inoue T, Miki Y, Abe K, Hatori M, Hosaka M, Kariya Y, Kakuo S, Fujimura T, Hachiya A, Aiba S, Sasano H.
Mol Cell Endocrinol 2011 Jun; 344:35.
Application:IHC-P, Human, Skin.
-
Increased estrogen sulfatase (STS) and 17beta-hydroxysteroid dehydrogenase type 1(17beta-HSD1) following neoadjuvant aromatase inhibitor therapy in breast cancer patients.
Chanplakorn N, Chanplakorn P, Suzuki T, Ono K, Chan MS, Miki Y, Saji S, Ueno T, Toi M, Sasano H.
Breast Cancer Research and Treatment 2010 Apr; 120(3):639.
Application:IHC-P, Human, Human invasive ductal carcinoma.
-
Post-menopausal ovarian fibroma associated with steroid hormone synthesis: A case report.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com