HSD11B1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HSD11B1 full-length ORF ( AAH12593, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
57.86
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HSD11B1
Entrez GeneID
3290GeneBank Accession#
BC012593Protein Accession#
AAH12593Gene Name
HSD11B1
Gene Alias
11-DH, 11-beta-HSD1, HDL, HSD11, HSD11B, HSD11L, MGC13539, SDR26C1
Gene Description
hydroxysteroid (11-beta) dehydrogenase 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
11-beta-hydroxysteroid dehydrogenase 1|OTTHUMP00000034649|OTTHUMP00000034650|corticosteroid 11-beta-dehydrogenase isozyme 1|short chain dehydrogenase/reductase family 26C, member 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com