Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD11B1 (Human) Recombinant Protein (P01)

  • Catalog # : H00003290-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSD11B1 full-length ORF ( AAH12593, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 57.86
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003290-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3290
  • Gene Name:
  • HSD11B1
  • Gene Alias:
  • 11-DH,11-beta-HSD1,HDL,HSD11,HSD11B,HSD11L,MGC13539,SDR26C1
  • Gene Description:
  • hydroxysteroid (11-beta) dehydrogenase 1
  • Gene Summary:
  • The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 11-beta-hydroxysteroid dehydrogenase 1,OTTHUMP00000034649,OTTHUMP00000034650,corticosteroid 11-beta-dehydrogenase isozyme 1,short chain dehydrogenase/reductase family 26C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook