HSD11B1 monoclonal antibody (M02A), clone 2C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HSD11B1 monoclonal antibody (M02A), clone 2C10. Western Blot analysis of HSD11B1 expression in human liver.
Western Blot (Cell lysate)
HSD11B1 monoclonal antibody (M02A), clone 2C10. Western Blot analysis of HSD11B1 expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of HSD11B1 expression in transfected 293T cell line by HSD11B1 monoclonal antibody (M02A), clone 2C10.
Lane 1: HSD11B1 transfected lysate (Predicted MW: 32.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (57.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HSD11B1.
Immunogen
HSD11B1 (AAH12593, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Host
Mouse
Reactivity
Human
Isotype
IgM Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.86 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSD11B1 monoclonal antibody (M02A), clone 2C10. Western Blot analysis of HSD11B1 expression in human liver.Western Blot (Cell lysate)
HSD11B1 monoclonal antibody (M02A), clone 2C10. Western Blot analysis of HSD11B1 expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of HSD11B1 expression in transfected 293T cell line by HSD11B1 monoclonal antibody (M02A), clone 2C10.
Lane 1: HSD11B1 transfected lysate (Predicted MW: 32.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — HSD11B1
Entrez GeneID
3290GeneBank Accession#
BC012593Protein Accession#
AAH12593Gene Name
HSD11B1
Gene Alias
11-DH, 11-beta-HSD1, HDL, HSD11, HSD11B, HSD11L, MGC13539, SDR26C1
Gene Description
hydroxysteroid (11-beta) dehydrogenase 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
11-beta-hydroxysteroid dehydrogenase 1|OTTHUMP00000034649|OTTHUMP00000034650|corticosteroid 11-beta-dehydrogenase isozyme 1|short chain dehydrogenase/reductase family 26C, member 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com