Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD3B2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00003284-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human HSD3B2 protein.
  • Immunogen:
  • HSD3B2 (NP_000189.1, 1 a.a. ~ 372 a.a) full-length human protein.
  • Sequence:
  • MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPLTLMYWIGFLLEVVSFLLSPIYSYQPPFNRHTVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HSD3B2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSD3B2 expression in human placenta.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HSD3B2 expression in transfected 293T cell line (H00003284-T02) by HSD3B2 MaxPab polyclonal antibody.

    Lane 1: HSD3B2 transfected lysate(42.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3284
  • Gene Name:
  • HSD3B2
  • Gene Alias:
  • HSDB,HSDB3,SDR11E2
  • Gene Description:
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
  • Other Designations:
  • 3 beta-HSD type II,3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II,OTTHUMP00000014489,delta 5-delta 4-isomerase type II,hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 2,short ch
  • RSS
  • YouTube
  • Linkedin
  • Facebook