HES1 monoclonal antibody (M02), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HES1 monoclonal antibody (M02), clone 3A3. Western Blot analysis of HES1 expression in H9c2(2-1).
Immunofluorescence
Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HES1.
Immunogen
HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HES1 monoclonal antibody (M02), clone 3A3. Western Blot analysis of HES1 expression in H9c2(2-1).ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HES1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HES1
Entrez GeneID
3280GeneBank Accession#
NM_005524Protein Accession#
NP_005515Gene Name
HES1
Gene Alias
FLJ20408, HES-1, HHL, HRY, bHLHb39
Gene Description
hairy and enhancer of split 1, (Drosophila)
Omim ID
139605Gene Ontology
HyperlinkGene Summary
This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq
Other Designations
hairy and enhancer of split 1|hairy homolog|transcription factor HES-1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Inhibition of breast cancer cell survival by Xanthohumol via modulation of the Notch signaling pathway in vivo and in vitro.
Sun Z, Zhou C, Liu F, Zhang W, Chen J, Pan Y, Ma L, Liu Q, Du Y, Yang J, Wang Q.
Oncology Letters 2018 Jan; 15(1):908.
Application：WB-Ce, Human, MCF-10A, MDA-MB-231 cells.
-
Inhibition of breast cancer cell survival by Xanthohumol via modulation of the Notch signaling pathway in vivo and in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com