Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HES1 polyclonal antibody (A01)

  • Catalog # : H00003280-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HES1.
  • Immunogen:
  • HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003280-A01
    Western Blot detection against Immunogen (37.88 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3280
  • Gene Name:
  • HES1
  • Gene Alias:
  • FLJ20408,HES-1,HHL,HRY,bHLHb39
  • Gene Description:
  • hairy and enhancer of split 1, (Drosophila)
  • Gene Summary:
  • This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq
  • Other Designations:
  • hairy and enhancer of split 1,hairy homolog,transcription factor HES-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook