PRMT2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRMT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRMT2 expression in human kidney.
Western Blot (Cell lysate)
PRMT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRMT2 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of PRMT2 expression in transfected 293T cell line (H00003275-T02) by PRMT2 MaxPab polyclonal antibody.
Lane 1: PRMT2 transfected lysate(49.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PRMT2 protein.
Immunogen
PRMT2 (NP_001526.2, 1 a.a. ~ 433 a.a) full-length human protein.
Sequence
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRMT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRMT2 expression in human kidney.Western Blot (Cell lysate)
PRMT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRMT2 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of PRMT2 expression in transfected 293T cell line (H00003275-T02) by PRMT2 MaxPab polyclonal antibody.
Lane 1: PRMT2 transfected lysate(49.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PRMT2
Entrez GeneID
3275GeneBank Accession#
NM_001535.2Protein Accession#
NP_001526.2Gene Name
PRMT2
Gene Alias
HRMT1L1, MGC111373
Gene Description
protein arginine methyltransferase 2
Omim ID
601961Gene Ontology
HyperlinkGene Summary
S. cerevisiae)-like 1|HMT1 hnRNP methyltransferase-like 1|OTTHUMP00000115881|PRMT2 alpha|PRMT2 beta|PRMT2 gamma|protein arginine N-methyltransferase 2
Other Designations
HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1|HMT1 hnRNP methyltransferase-like 1|OTTHUMP00000115881|PRMT2 alpha|PRMT2 beta|PRMT2 gamma|protein arginine N-methyltransferase 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com