HPS1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HPS1 partial ORF ( NP_000186.2, 96 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GDHTESEGDLRRKLYVLKYLFEVHFGLVTVDGHLIRKELRPPDLAQRVQLWEHFQSLLWTYSRLREQEQCFAVEALERLIHPQLCELCIEALERHVIQAVNTSPE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.29
Interspecies Antigen Sequence
Mouse (79); Rat (83)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HPS1
Entrez GeneID
3257GeneBank Accession#
NM_000195Protein Accession#
NP_000186.2Gene Name
HPS1
Gene Alias
HPS, MGC5277
Gene Description
Hermansky-Pudlak syndrome 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is a component of three different protein complexes termed biogenesis of lysosome-related organelles complex (BLOC)-3, BLOC4, and BLOC5. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 1. Multiple transcript variants encoding distinct isoforms have been identified for this gene; the full-length sequences of some of these have not been determined yet. [provided by RefSeq
Other Designations
Hermansky-Pudlak syndrome 1 protein|Hermansky-Pudlak syndrome type 1|OTTHUMP00000020245|OTTHUMP00000020246
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com