Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HPGD (Human) Recombinant Protein (P01)

  • Catalog # : H00003248-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HPGD full-length ORF ( AAH18986, 1 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 55.00
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003248-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3248
  • Gene Name:
  • HPGD
  • Gene Alias:
  • 15-PGDH,PGDH,PGDH1,SDR36C1
  • Gene Description:
  • hydroxyprostaglandin dehydrogenase 15-(NAD)
  • Gene Summary:
  • This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 15-hydroxy prostaglandin dehydrogenase,15-hydroxyprostaglandin dehydrogenase,NAD+-dependent 15-hydroxyprostaglandin dehydrogenase,short chain dehydrogenase/reductase family 36C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook