Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

  • By Biomarker

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HPGD purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00003248-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human HPGD protein.
  • Immunogen:
  • HPGD (AAH18986.1, 1 a.a. ~ 266 a.a) full-length human protein.
  • Sequence:
  • MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HPGD expression in transfected 293T cell line (H00003248-T01) by HPGD MaxPab polyclonal antibody.

    Lane 1: HPGD transfected lysate(29.37 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3248
  • Gene Name:
  • HPGD
  • Gene Alias:
  • 15-PGDH,PGDH,PGDH1,SDR36C1
  • Gene Description:
  • hydroxyprostaglandin dehydrogenase 15-(NAD)
  • Gene Summary:
  • This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 15-hydroxy prostaglandin dehydrogenase,15-hydroxyprostaglandin dehydrogenase,NAD+-dependent 15-hydroxyprostaglandin dehydrogenase,short chain dehydrogenase/reductase family 36C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook