HOXD11 monoclonal antibody (M10), clone 6C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXD11.
Immunogen
HOXD11 (NP_067015, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXD11 monoclonal antibody (M10), clone 6C8 Western Blot analysis of HOXD11 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HOXD11 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.7 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXD11 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — HOXD11
Entrez GeneID
3237GeneBank Accession#
NM_021192Protein Accession#
NP_067015Gene Name
HOXD11
Gene Alias
HOX4, HOX4F
Gene Description
homeobox D11
Omim ID
142986Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis. [provided by RefSeq
Other Designations
Hox-4.6, mouse, homolog of|homeo box 4F|homeo box D11|homeobox protein Hox-D11
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com