HOXD9 monoclonal antibody (M01), clone 2A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HOXD9 monoclonal antibody (M01), clone 2A9 Western Blot analysis of HOXD9 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot detection against Immunogen (33.15 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXD9.
Immunogen
HOXD9 (NP_055028, 146 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAA*
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (78); Rat (70)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.15 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXD9 monoclonal antibody (M01), clone 2A9 Western Blot analysis of HOXD9 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — HOXD9
Entrez GeneID
3235GeneBank Accession#
NM_014213Protein Accession#
NP_055028Gene Name
HOXD9
Gene Alias
HOX4, HOX4C, Hox-4.3, Hox-5.2
Gene Description
homeobox D9
Omim ID
142982Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. [provided by RefSeq
Other Designations
Hox-4.3, mouse, homolog of|homeo box D9|homeobox protein Hox-D9
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com