Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HOXD9 monoclonal antibody (M01), clone 2A9

  • Catalog # : H00003235-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HOXD9.
  • Immunogen:
  • HOXD9 (NP_055028, 146 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAA*
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003235-M01
    Western Blot detection against Immunogen (33.15 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HOXD9 monoclonal antibody (M01), clone 2A9 Western Blot analysis of HOXD9 expression in NIH/3T3 ( Cat # L018V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3235
  • Gene Name:
  • HOXD9
  • Gene Alias:
  • HOX4,HOX4C,Hox-4.3,Hox-5.2
  • Gene Description:
  • homeobox D9
  • Gene Summary:
  • This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. [provided by RefSeq
  • Other Designations:
  • Hox-4.3, mouse, homolog of,homeo box D9,homeobox protein Hox-D9
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook