HOXD8 monoclonal antibody (M01), clone 10F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXD8.
Immunogen
HOXD8 (NP_062458, 126 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXD8 expression in transfected 293T cell line by HOXD8 monoclonal antibody (M01), clone 10F8.
Lane 1: HOXD8 transfected lysate(31.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXD8 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HOXD8 over-expressed 293 cell line, cotransfected with HOXD8 Validated Chimera RNAi ( Cat # H00003234-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HOXD8 monoclonal antibody (M01), clone 10F8 (Cat # H00003234-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — HOXD8
Entrez GeneID
3234GeneBank Accession#
NM_019558Protein Accession#
NP_062458Gene Name
HOXD8
Gene Alias
HOX4, HOX4E, HOX5.4
Gene Description
homeobox D8
Omim ID
142985Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. [provided by RefSeq
Other Designations
Hox-4.5, mouse, homolog of|homeo box 4E|homeo box D8|homeobox protein 5.4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com