HOXC13 monoclonal antibody (M01), clone 10D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HOXC13 monoclonal antibody (M01), clone 10D4 Western Blot analysis of HOXC13 expression in A-549 ( Cat # L025V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC13 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC13.
Immunogen
HOXC13 (NP_059106, 132 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXC13 monoclonal antibody (M01), clone 10D4 Western Blot analysis of HOXC13 expression in A-549 ( Cat # L025V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC13 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HOXC13
Entrez GeneID
3229GeneBank Accession#
NM_017410Protein Accession#
NP_059106Gene Name
HOXC13
Gene Alias
HOX3, HOX3G
Gene Description
homeobox C13
Omim ID
142976Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the development of hair, nail, and filiform papilla. [provided by RefSeq
Other Designations
NUP98/HOXC13|homeo box 3G|homeo box C13|homeobox protein Hox-C13
-
Interactome
-
Publication Reference
-
Palmitoylation Regulates Epidermal Homeostasis and Hair Follicle Differentiation.
Mill P, Lee AW, Fukata Y, Tsutsumi R, Fukata M, Keighren M, Porter RM, McKie L, Smyth I, Jackson IJ.
PLoS Genetics 2009 Nov; 5(11):e1000748.
Application：IF, IHC-P, Mouse, Mouse hair follicles.
-
Dlx3 is a crucial regulator of hair follicle differentiation and cycling.
Hwang J, Mehrani T, Millar SE, Morasso MI.
Development 2008 Aug; 135(18):3149.
-
Palmitoylation Regulates Epidermal Homeostasis and Hair Follicle Differentiation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com