HOXC10 polyclonal antibody (A02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HOXC10 polyclonal antibody (A02), Lot # 060729QCS1 Western Blot analysis of HOXC10 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HOXC10.
Immunogen
HOXC10 (AAH01293, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Sequence
LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXC10 polyclonal antibody (A02), Lot # 060729QCS1 Western Blot analysis of HOXC10 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — HOXC10
Entrez GeneID
3226GeneBank Accession#
BC001293Protein Accession#
AAH01293Gene Name
HOXC10
Gene Alias
HOX3I, MGC5259
Gene Description
homeobox C10
Omim ID
605560Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation. [provided by RefSeq
Other Designations
homeo box C10|homeobox protein Hox-C10|homeoprotein C10
-
Interactome
-
Publication Reference
-
Transcriptome Analysis Revealed Unique Genes as Targets for the Anti-inflammatory Action of Activated Protein C in Human Macrophages.
Pereira CP, Bachli EB, Schaer DJ, Schoedon G.
PLoS One 2010 Oct; 5(10):e15352.
Application：WB, Human, Monocyte.
-
Transcriptome Analysis Revealed Unique Genes as Targets for the Anti-inflammatory Action of Activated Protein C in Human Macrophages.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com