HOXC8 monoclonal antibody (M02), clone 1H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC8.
Immunogen
HOXC8 (NP_073149, 47 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HOXC8 transfected lysate using anti-HOXC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXC8 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — HOXC8
Entrez GeneID
3224GeneBank Accession#
NM_022658Protein Accession#
NP_073149Gene Name
HOXC8
Gene Alias
HOX3, HOX3A
Gene Description
homeobox C8
Omim ID
142970Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq
Other Designations
Hox-3.1, mouse, homolog of|homeo box 3A|homeo box C8|homeobox protein Hox-C8
-
Interactome
-
Publication Reference
-
DLX5 and HOXC8 enhance the chondrogenic differentiation potential of stem cells from apical papilla via LINC01013.
Haoqing Yang, Yangyang Cao, Jianpeng Zhang, Yuncun Liang, Xiaomin Su, Chen Zhang, Huina Liu, Xiao Han, Lihua Ge, Zhipeng Fan.
Stem Cell Research & Therapy 2020 Jul; 11(1):271.
Application:IP, WB-Tr, Human, Stem cells from apical papilla.
-
Homeobox C8 inhibited the osteo-/dentinogenic differentiation and migration ability of stem cells of the apical papilla via activating KDM1A.
Yang H, Liang Y, Cao Y, Cao Y, Fan Z.
Journal of Cellular Physiology 2020 Nov; 235(11):8432.
Application:ChIP, WB-Tr, Human, SCAPs.
-
DLX5 and HOXC8 enhance the chondrogenic differentiation potential of stem cells from apical papilla via LINC01013.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com