HOXC8 monoclonal antibody (M01), clone 5G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC8.
Immunogen
HOXC8 (NP_073149, 47 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC8 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HOXC8
Entrez GeneID
3224GeneBank Accession#
NM_022658Protein Accession#
NP_073149Gene Name
HOXC8
Gene Alias
HOX3, HOX3A
Gene Description
homeobox C8
Omim ID
142970Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq
Other Designations
Hox-3.1, mouse, homolog of|homeo box 3A|homeo box C8|homeobox protein Hox-C8
-
Interactome
-
Publication Reference
-
Ratio of miR-196s to HOXC8 Messenger RNA Correlates with Breast Cancer Cell Migration and Metastasis.
Li Y, Zhang M, Chen H, Dong Z, Ganapathy V, Thangaraju M, Huang S.
Cancer Research 2010 Oct; 70(20):7894.
Application:WB-Tr, Human, MDA-MB-231 cells.
-
Ratio of miR-196s to HOXC8 Messenger RNA Correlates with Breast Cancer Cell Migration and Metastasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com