HOXC8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HOXC8 expression in transfected 293T cell line (H00003224-T01) by HOXC8 MaxPab polyclonal antibody.
Lane 1: HOXC8 transfected lysate(26.62 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HOXC8 protein.
Immunogen
HOXC8 (NP_073149.1, 1 a.a. ~ 242 a.a) full-length human protein.
Sequence
MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXC8 expression in transfected 293T cell line (H00003224-T01) by HOXC8 MaxPab polyclonal antibody.
Lane 1: HOXC8 transfected lysate(26.62 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HOXC8
Entrez GeneID
3224GeneBank Accession#
NM_022658.3Protein Accession#
NP_073149.1Gene Name
HOXC8
Gene Alias
HOX3, HOX3A
Gene Description
homeobox C8
Omim ID
142970Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq
Other Designations
Hox-3.1, mouse, homolog of|homeo box 3A|homeo box C8|homeobox protein Hox-C8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com