HOXC6 monoclonal antibody (M04), clone 2A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HOXC6 monoclonal antibody (M04), clone 2A4. Western Blot analysis of HOXC6 expression in Hela S3 NE.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC6 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC6.
Immunogen
HOXC6 (NP_004494.1, 53 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXC6 monoclonal antibody (M04), clone 2A4. Western Blot analysis of HOXC6 expression in Hela S3 NE.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC6 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — HOXC6
Entrez GeneID
3223GeneBank Accession#
NM_004503Protein Accession#
NP_004494.1Gene Name
HOXC6
Gene Alias
CP25, HHO.C8, HOX3, HOX3C
Gene Description
homeobox C6
Omim ID
142972Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family, members of which encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC6, is one of several HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Alternatively spliced transcript variants encoding different isoforms have been identified for HOXC6. Transcript variant two includes the shared exon, and transcript variant one includes only gene-specific exons. [provided by RefSeq
Other Designations
homeo box 3C|homeo box C6|homeo box C8 protein|homeobox protein Hox-C6
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com