HOXC5 monoclonal antibody (M01), clone 1E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.22 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC5.
Immunogen
HOXC5 (NP_061826.1, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.22 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — HOXC5
Entrez GeneID
3222GeneBank Accession#
NM_018953Protein Accession#
NP_061826.1Gene Name
HOXC5
Gene Alias
CP11, HOX3, HOX3D
Gene Description
homeobox C5
Omim ID
142973Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq
Other Designations
homeo box C5|homeobox protein Hox-C5
-
Interactome
-
Disease
-
Publication Reference
-
Homeobox family Hoxc localization during murine palate formation.
Hirata A, Katayama K, Tsuji T, Imura H, Natsume N, Sugahara T, Kunieda T, Nakamura H, Otsuki Y.
Congenital Anomalies 2016 Jul; 56(4):172.
Application：IF, IHC, Mouse, Secondary palate.
-
Homeobox family Hoxc localization during murine palate formation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com