HOXC4 monoclonal antibody (M01), clone 1E9

Catalog # H00003221-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

HOXC4 monoclonal antibody (M01), clone 1E9 Western Blot analysis of HOXC4 expression in A-549 ( Cat # L025V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 monoclonal antibody (M01), clone 1E9.

Lane 1: HOXC4 transfected lysate(29.8 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged HOXC4 is approximately 0.1ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of HOXC4 over-expressed 293 cell line, cotransfected with HOXC4 Validated Chimera RNAi ( Cat # H00003221-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HOXC4 monoclonal antibody (M01), clone 1E9 (Cat # H00003221-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (37.29 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant HOXC4.

    Immunogen

    HOXC4 (NP_705897, 160 a.a. ~ 264 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.29 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    HOXC4 monoclonal antibody (M01), clone 1E9 Western Blot analysis of HOXC4 expression in A-549 ( Cat # L025V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 monoclonal antibody (M01), clone 1E9.

    Lane 1: HOXC4 transfected lysate(29.8 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged HOXC4 is approximately 0.1ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of HOXC4 over-expressed 293 cell line, cotransfected with HOXC4 Validated Chimera RNAi ( Cat # H00003221-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HOXC4 monoclonal antibody (M01), clone 1E9 (Cat # H00003221-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — HOXC4

    Entrez GeneID

    3221

    GeneBank Accession#

    NM_153633

    Protein Accession#

    NP_705897

    Gene Name

    HOXC4

    Gene Alias

    HOX3, HOX3E, cp19

    Gene Description

    homeobox C4

    Omim ID

    142974

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons. [provided by RefSeq

    Other Designations

    homeo box 3E|homeo box C4

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All