HOXC4 monoclonal antibody (M01), clone 1E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC4.
Immunogen
HOXC4 (NP_705897, 160 a.a. ~ 264 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXC4 monoclonal antibody (M01), clone 1E9 Western Blot analysis of HOXC4 expression in A-549 ( Cat # L025V1 ).Western Blot (Transfected lysate)
Western Blot analysis of HOXC4 expression in transfected 293T cell line by HOXC4 monoclonal antibody (M01), clone 1E9.
Lane 1: HOXC4 transfected lysate(29.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC4 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HOXC4 over-expressed 293 cell line, cotransfected with HOXC4 Validated Chimera RNAi ( Cat # H00003221-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HOXC4 monoclonal antibody (M01), clone 1E9 (Cat # H00003221-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — HOXC4
Entrez GeneID
3221GeneBank Accession#
NM_153633Protein Accession#
NP_705897Gene Name
HOXC4
Gene Alias
HOX3, HOX3E, cp19
Gene Description
homeobox C4
Omim ID
142974Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC4, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants that encode the same protein have been described for HOXC4. Transcript variant one includes the shared exon, and transcript variant two includes only gene-specific exons. [provided by RefSeq
Other Designations
homeo box 3E|homeo box C4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com