HOXB9 purified MaxPab rabbit polyclonal antibody (D03P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HOXB9 protein.
Immunogen
HOXB9 (NP_076922.1, 1 a.a. ~ 250 a.a) full-length human protein.
Sequence
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HOXB9 MaxPab rabbit polyclonal antibody. Western Blot analysis of HOXB9 expression in mouse liver.Western Blot (Tissue lysate)
HOXB9 MaxPab rabbit polyclonal antibody. Western Blot analysis of HOXB9 expression in human liver.Western Blot (Cell lysate)
HOXB9 MaxPab rabbit polyclonal antibody. Western Blot analysis of HOXB9 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of HOXB9 expression in transfected 293T cell line (H00003219-T01) by HOXB9 MaxPab polyclonal antibody.
Lane 1: HOXB9 transfected lysate(28.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HOXB9
Entrez GeneID
3219GeneBank Accession#
NM_024017.4Protein Accession#
NP_076922.1Gene Name
HOXB9
Gene Alias
HOX-2.5, HOX2, HOX2E
Gene Description
homeobox B9
Omim ID
142964Gene Ontology
HyperlinkGene Summary
This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq
Other Designations
homeo box 2E|homeo box B9
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com