HOXB7 monoclonal antibody (M04), clone 5B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M04), clone 5B2.
Lane 1: HOXB7 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXB7 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of HOXB7 over-expressed 293 cell line, cotransfected with HOXB7 Validated Chimera RNAi ( Cat # H00003217-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HOXB7 monoclonal antibody (M04), clone 5B2 (Cat # H00003217-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXB7.
Immunogen
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M04), clone 5B2.
Lane 1: HOXB7 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXB7 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of HOXB7 over-expressed 293 cell line, cotransfected with HOXB7 Validated Chimera RNAi ( Cat # H00003217-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HOXB7 monoclonal antibody (M04), clone 5B2 (Cat # H00003217-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — HOXB7
Entrez GeneID
3217GeneBank Accession#
NM_004502Protein Accession#
NP_004493Gene Name
HOXB7
Gene Alias
HHO.C1, HOX2, HOX2C, Hox-2.3
Gene Description
homeobox B7
Omim ID
142962Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq
Other Designations
homeo box 2C|homeo box B7|homeo box c1 protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com