HOXB7 monoclonal antibody (M03), clone 4C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXB7.
Immunogen
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HOXB7 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXB7 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — HOXB7
Entrez GeneID
3217GeneBank Accession#
NM_004502Protein Accession#
NP_004493Gene Name
HOXB7
Gene Alias
HHO.C1, HOX2, HOX2C, Hox-2.3
Gene Description
homeobox B7
Omim ID
142962Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq
Other Designations
homeo box 2C|homeo box B7|homeo box c1 protein
-
Interactome
-
Disease
-
Publication Reference
-
HOXB7 acts as an oncogenic biomarker in head and neck squamous cell carcinoma.
Xiang Wu, Jin Li, Tingyuan Yan, Xueping Ke, Xin Li, Yumin Zhu, Jianrong Yang, Zhongwu Li.
Cancer Cell International 2021 Jul; 21(1):393.
Application:IF, IHC-P, WB-Ce, WB-Tr, Human, Mouse, Cal27, Fadu, HN4, HN6 cells, Human head and neck squamous cell carcinoma, Human oral keratinocytes, Mouse tumors, SCC9, SCC25 cells.
-
Long non-coding RNA SNHG8 promotes prostate cancer progression through repressing miR-384 and up-regulating HOXB7.
Zhenfeng Shi, Hao Zhang, Situ Jie, Xiaojian Yang, Qunxiong Huang, Yunhua Mao, Yan Zhang.
The Journal of Gene Medicine 2021 Mar; 23(3):e3309.
Application:IHC-P, Human, Human prostate cancer.
-
HOXB7 mediates cisplatin resistance in esophageal squamous cell carcinoma through involvement of DNA damage repair.
Zhou T, Fu H, Dong B, Dai L, Yang Y, Yan W, Shen L.
Thoracic Cancer 2019 Sep; [Epub].
Application:IHC-P, Human, Esophageal squamous cell carcinoma.
-
Impact of co-blocking the costimulatory signals on immune-related genes after high-risk rabbit corneal allograft using 2nd-generation DNA sequencing technology.
Zhao HX, Li XY, Guan WY, Han XT.
Genetics and Molecular Biology 2019 Apr; 42(2):472.
Application:Func, Rabbit, Rabbit corneal allograft.
-
Upregulated expression of HOXB7 in intrahepatic cholangiocarcinoma is associated with tumor cell metastasis and poor prognosis.
Dai L, Hu W, Yang Z, Chen D, He B, Chen Y, Zhou L, Xie H, Wu J, Zheng S.
Laboratory Investigation; a Journal of Technical Methods and Pathology 2019 Jun; 99(6):736.
Application:IHC-P, Human, Human intrahepatic cholangiocarcinoma.
-
Deregulated HOXB7 Expression Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma and Regulates Cancer Cell Proliferation In Vitro and In Vivo.
Hui Li, Lu-Yan Shen, Wan-Pu Yan, Bin Dong , Xiao-Zheng Kang, Liang Dai, YongBo Yang, Hao Fu, He-Li Yang, Hai-Tao Zhou, Chuan Huang, Zhen Liang, HongChao Xiong, Ke-Neng Chen.
PLoS One 2015 Jun; 10(6):e0130551.
Application:IHC-P, WB-Tr, Human, Esophageal squamous cell carcinoma, EC109, KYSE150 cells.
-
A novel predictive equation for potential diagnosis of cholangiocarcinoma.
Kraiklang R, Pairojkul C, Khuntikeo N, Imtawil K, Wongkham S, Wongkham C.
PloS One 2014 Feb; 9(2):e89337.
Application:IHC, Human, Cholangiocarcinomas, Hepatocellularcarcinoma.
-
HOXB7 acts as an oncogenic biomarker in head and neck squamous cell carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com