HOXB3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HOXB3 partial ORF ( NP_002137.4, 272 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TAGFMNALHSMTPSYESPSPPAFGKAHQNAYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HOXB3
Entrez GeneID
3213GeneBank Accession#
NM_002146Protein Accession#
NP_002137.4Gene Name
HOXB3
Gene Alias
HOX2, HOX2G, Hox-2.7
Gene Description
homeobox B3
Omim ID
142966Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML). [provided by RefSeq
Other Designations
homeo box 2G|homeo box B3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com