HOXB1 monoclonal antibody (M13), clone 2E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M13), clone 2E5.
Lane 1: HOXB1 transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HOXB1 transfected lysate using anti-HOXB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB1 MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (37.73 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXB1.
Immunogen
HOXB1 (NP_002135.2, 101 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXB1 expression in transfected 293T cell line by HOXB1 monoclonal antibody (M13), clone 2E5.
Lane 1: HOXB1 transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HOXB1 transfected lysate using anti-HOXB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB1 MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — HOXB1
Entrez GeneID
3211GeneBank Accession#
NM_002144Protein Accession#
NP_002135.2Gene Name
HOXB1
Gene Alias
HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845
Gene Description
homeobox B1
Omim ID
142968Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq
Other Designations
homeo box 2I|homeo box B1|homeobox protein Hox-B1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com