HOXB1 monoclonal antibody (M01), clone 3D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXB1 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.88 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXB1.
Immunogen
HOXB1 (NP_002135, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (85)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.88 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXB1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — HOXB1
Entrez GeneID
3211GeneBank Accession#
NM_002144Protein Accession#
NP_002135Gene Name
HOXB1
Gene Alias
HOX2, HOX2I, Hox-2.9, MGC116843, MGC116844, MGC116845
Gene Description
homeobox B1
Omim ID
142968Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. [provided by RefSeq
Other Designations
homeo box 2I|homeo box B1|homeobox protein Hox-B1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com