Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HOXA11 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003207-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HOXA11 partial ORF ( NP_005514, 60 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003207-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3207
  • Gene Name:
  • HOXA11
  • Gene Alias:
  • HOX1,HOX1I
  • Gene Description:
  • homeobox A11
  • Gene Summary:
  • In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000025055,homeo box 1I,homeo box A11,homeobox protein HOXA11
  • RSS
  • YouTube
  • Linkedin
  • Facebook