HOXA7 monoclonal antibody (M01), clone 2F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXA7.
Immunogen
HOXA7 (NP_008827, 58 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.79 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.
Lane 1: HOXA7 transfected lysate(25.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HOXA7
Entrez GeneID
3204GeneBank Accession#
NM_006896Protein Accession#
NP_008827Gene Name
HOXA7
Gene Alias
ANTP, HOX1, HOX1.1, HOX1A
Gene Description
homeobox A7
Omim ID
142950Gene Ontology
HyperlinkGene Summary
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. For example, the encoded protein represses the transcription of differentiation-specific genes during keratinocyte proliferation, but this repression is then overcome by differentiation signals. This gene is highly similar to the antennapedia (Antp) gene of Drosophila. [provided by RefSeq
Other Designations
OTTHUMP00000024835|homeo box A7|homeobox protein HOX-1A
-
Interactome
-
Disease
-
Publication Reference
-
Molecular features and vulnerabilities of recurrent chordomas.
Carolin Seeling, André Lechel, Michael Svinarenko, Peter Möller, Thomas F E Barth, Kevin Mellert.
Journal of Experimental & Clinical Cancer Research 2021 Jul; 40(1):244.
Application:WB-Tr, Human, U-CH1 cells.
-
HOX gene analysis of endothelial cell differentiation in human bone marrow-derived mesenchymal stem cells.
Chung N, Jee BK, Chae SW, Jeon YW, Lee KH, Rha HK.
Molecular Biology Reports 2007 Oct; 36(2):227.
Application:WB, Human, Human bone marrow-derived mesenchymal stem cells (hMSCs).
-
Molecular features and vulnerabilities of recurrent chordomas.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com