HOXA6 monoclonal antibody (M01), clone 3A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXA6.
Immunogen
HOXA6 (NP_076919, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXA6 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — HOXA6
Entrez GeneID
3203GeneBank Accession#
NM_024014Protein Accession#
NP_076919Gene Name
HOXA6
Gene Alias
HOX1, HOX1.2, HOX1B
Gene Description
homeobox A6
Omim ID
142951Gene Ontology
HyperlinkGene Summary
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq
Other Designations
homeo box 1B|homeo box A6|homeobox protein HOXA6
-
Interactome
-
Publication Reference
-
Leukemic fusion genes MLL/AF4 and AML1/MTG8 support leukemic self-renewal by controlling expression of the telomerase subunit TERT.
Gessner A, Thomas M, Garrido Castro P, Buchler L, Scholz A, Brummendorf TH, Martinez Soria N, Vormoor J, Greil J, Heidenreich O.
Leukemia 2010 Oct; 24(10):1751.
Application：WB-Tr, Human, SEM cells.
-
Leukemic fusion genes MLL/AF4 and AML1/MTG8 support leukemic self-renewal by controlling expression of the telomerase subunit TERT.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com