HOXA1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HOXA1 expression in transfected 293T cell line (H00003198-T01) by HOXA1 MaxPab polyclonal antibody.
Lane 1: HOXA1 transfected lysate(36.85 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HOXA1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HOXA1 protein.
Immunogen
HOXA1 (NP_005513.1, 1 a.a. ~ 335 a.a) full-length human protein.
Sequence
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HOXA1 expression in transfected 293T cell line (H00003198-T01) by HOXA1 MaxPab polyclonal antibody.
Lane 1: HOXA1 transfected lysate(36.85 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HOXA1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HOXA1
Entrez GeneID
3198GeneBank Accession#
NM_005522.4Protein Accession#
NP_005513.1Gene Name
HOXA1
Gene Alias
BSAS, HOX1, HOX1F, MGC45232
Gene Description
homeobox A1
Gene Ontology
HyperlinkGene Summary
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq
Other Designations
HOX A1 homeodomain protein|Hox 1.6-like protein|homeo box A1|homeobox 1F|homeobox protein HOX-A1|lab-like protein
-
Interactome
-
Disease
-
Publication Reference
-
Proinvasion metastasis drivers in early-stage melanoma are oncogenes.
Scott KL, Nogueira C, Heffernan TP, van Doorn R, Dhakal S, Hanna JA, Min C, Jaskelioff M, Xiao Y, Wu CJ, Cameron LA, Perry SR, Zeid R, Feinberg T, Kim M, Vande Woude G, Granter SR, Bosenberg M, Chu GC, Depinho RA, Rimm DL, Chin L.
Cancer Cell 2011 Jul; 20:92.
Application：IF, Human, Melanoma.
-
Proinvasion metastasis drivers in early-stage melanoma are oncogenes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com