HNRNPC monoclonal antibody (M02), clone 4E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HNRNPC expression in transfected 293T cell line by HNRNPC monoclonal antibody (M02), clone 4E8.
Lane 1: HNRNPC transfected lysate (Predicted MW: 32.34 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HNRNPC is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (54.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant HNRNPC.
Immunogen
HNRNPC (AAH89438.1, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (75)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HNRNPC expression in transfected 293T cell line by HNRNPC monoclonal antibody (M02), clone 4E8.
Lane 1: HNRNPC transfected lysate (Predicted MW: 32.34 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HNRNPC is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — HNRNPC
Entrez GeneID
3183GeneBank Accession#
BC089438.1Protein Accession#
AAH89438.1Gene Name
HNRNPC
Gene Alias
C1, C2, HNRNP, HNRPC, MGC104306, MGC105117, MGC117353, MGC131677, SNRPC
Gene Description
heterogeneous nuclear ribonucleoprotein C (C1/C2)
Omim ID
164020Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. [provided by RefSeq
Other Designations
heterogeneous nuclear ribonucleoprotein C|nuclear ribonucleoprotein particle C1 protein|nuclear ribonucleoprotein particle C2 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com