HNRNPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00003178-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of HNRNPA1 expression in transfected 293T cell line (H00003178-T05) by HNRNPA1 MaxPab polyclonal antibody.

Lane 1: HNRNPA1 transfected lysate(34.20 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human HNRNPA1 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    HNRNPA1 (NP_002127.1, 1 a.a. ~ 320 a.a) full-length human protein.

    Sequence

    MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

    Host

    Rabbit

    Reactivity

    Human

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of HNRNPA1 expression in transfected 293T cell line (H00003178-T05) by HNRNPA1 MaxPab polyclonal antibody.

    Lane 1: HNRNPA1 transfected lysate(34.20 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — HNRNPA1

    Entrez GeneID

    3178

    GeneBank Accession#

    NM_002136.2

    Protein Accession#

    NP_002127.1

    Gene Name

    HNRNPA1

    Gene Alias

    HNRPA1, MGC102835

    Gene Description

    heterogeneous nuclear ribonucleoprotein A1

    Omim ID

    164017

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites. [provided by RefSeq

    Other Designations

    helix-destabilizing protein|heterogeneous nuclear ribonucleoprotein A1B protein|heterogeneous nuclear ribonucleoprotein B2 protein|heterogeneous nuclear ribonucleoprotein core protein A1|nuclear ribonucleoprotein particle A1 protein|single-strand DNA-bind

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All