Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HNF4A (Human) Recombinant Protein (Q01)

  • Catalog # : H00003172-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HNF4A partial ORF ( NP_000448, 324 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003172-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3172
  • Gene Name:
  • HNF4A
  • Gene Alias:
  • FLJ39654,HNF4,HNF4a7,HNF4a8,HNF4a9,MODY,MODY1,NR2A1,NR2A21,TCF,TCF14
  • Gene Description:
  • hepatocyte nuclear factor 4, alpha
  • Gene Summary:
  • The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • HNF4-alpha,OTTHUMP00000031060,OTTHUMP00000031062,hepatic nuclear factor 4 alpha,hepatocyte nuclear factor 4 alpha,transcription factor-14
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook