Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXA3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003171-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FOXA3 partial ORF ( NP_004488.2, 266 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.09
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003171-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3171
  • Gene Name:
  • FOXA3
  • Gene Alias:
  • FKHH3,HNF3G,MGC10179,TCF3G
  • Gene Description:
  • forkhead box A3
  • Gene Summary:
  • This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq
  • Other Designations:
  • hepatocyte nuclear factor 3, gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook