FOXA2 monoclonal antibody (M12), clone 6C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Immunogen
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXA2 monoclonal antibody (M12), clone 6C12 Western Blot analysis of FOXA2 expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FOXA2
Entrez GeneID
3170GeneBank Accession#
NM_021784Protein Accession#
NP_068556Gene Name
FOXA2
Gene Alias
HNF3B, MGC19807, TCF3B
Gene Description
forkhead box A2
Omim ID
600288Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030409|OTTHUMP00000030410|hepatic nuclear factor-3-beta|hepatocyte nuclear factor 3, beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
An optimized Nurr1 agonist provides disease-modifying effects in Parkinson's disease models.
Woori Kim, Mohit Tripathi, Chunhyung Kim, Satyapavan Vardhineni, Young Cha, Shamseer Kulangara Kandi, Melissa Feitosa, Rohit Kholiya, Eric Sah, Anuj Thakur, Yehan Kim, Sanghyeok Ko, Kaiya Bhatia, Sunny Manohar, Young-Bin Kong, Gagandeep Sindhu, Yoon-Seong Kim, Bruce Cohen, Diwan S Rawat, Kwang-Soo Kim.
Nature Communications 2023 Jul; 14(1):4283.
Application:WB-Ce, Mouse, MN9D cells.
-
An artificial LAMA2-GelMA hydrogel microenvironment for the development of pancreatic endocrine progenitors.
Yan Huang, Yang Xu, Jiachen Zhu, Jian Wan, Yicheng Xiong, Zhaoyan Jiang, Shajun Zhu, Qingsong Guo, Yuxi Li, Yuhua Lu, Bin Yu, Yibing Guo, Zhiwei Wang, Yumin Yang.
Biomaterials 2022 Dec; 291:121882.
Application:IF, Human, Posterior foregut cells (differentiated from H9 cells).
-
An iPSC line derived from a human acute myeloid leukemia cell line (HL-60-iPSC) retains leukemic abnormalities and displays myeloid differentiation defects.
Amanda E Yamasaki, Jane N Warshaw, Beverly L Kyalwazi, Hiroko Matsui, Kristen Jepsen, Athanasia D Panopoulos.
Stem Cell Research 2020 Dec; 49:102096.
Application:IF, Human, HL-60 cells.
-
Differential requirements of androgen receptor in luminal progenitors during prostate regeneration and tumor initiation.
Chee Wai Chua, Nusrat J Epsi, Eva Y Leung, Shouhong Xuan, Ming Lei, Bo I Li, Sarah K Bergren, Hanina Hibshoosh, Antonina Mitrofanova, Michael M Shen.
Elife 2018 Jan; 7:e28768.
Application:IHC, Mouse, Prostate.
-
An optimized Nurr1 agonist provides disease-modifying effects in Parkinson's disease models.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com