FOXA2 monoclonal antibody (M10), clone 1C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Immunogen
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXA2 monoclonal antibody (M10), clone 1C7 Western Blot analysis of FOXA2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml]Immunoprecipitation
Immunoprecipitation of FOXA2 transfected lysate using anti-FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — FOXA2
Entrez GeneID
3170GeneBank Accession#
NM_021784Protein Accession#
NP_068556Gene Name
FOXA2
Gene Alias
HNF3B, MGC19807, TCF3B
Gene Description
forkhead box A2
Omim ID
600288Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030409|OTTHUMP00000030410|hepatic nuclear factor-3-beta|hepatocyte nuclear factor 3, beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Generation and characterization of a human induced pluripotent stem cell line heterozygous for a NOTCH1 mutation (NCHi014-A).
Mona Aljuhani, Talita Z Choudhury, Yang Yu, Shiqiao Ye, Mingtao Zhao, Vidu Garg.
Stem Cell Research 2024 Feb; 74:103281.
Application:ICC, Human, Human Stem Cells.
-
Characterization of an induced pluripotent stem cell line NCHi011-A from a 23-year-old female with Alagille Syndrome harboring a heterozygous JAG1 pathogenic variant.
Isaac Stanberry, David Cunningham, Shiqiao Ye, Matthew Alonzo, Ming-Tao Zhao, Vidu Garg, Brenda Lilly.
Stem Cell Research 2023 Sep; 72:103213.
Application:IF, Human, NCHi011-A cells.
-
Generation of iPSC line NCHi012-A from a patient with Alagille syndrome and heterozygous pathogenic variant in the JAG1 gene.
David Cunningham, Isaac Stanberry, Shiqiao Ye, Matthew Alonzo, Ming-Tao Zhao, Vidu Garg, Brenda Lilly.
Stem Cell Research 2023 Sep; 71:103177.
Application:IF, Human, iPSC NCHi012-A cells.
-
Creation of iPSC line NCHi004-A from a patient with down syndrome and congenital heart defects.
Matthew Alonzo, Shiqiao Ye, Brian Beckman, Karen Texter, Vidu Garg, Ming-Tao Zhao.
Stem Cell Research 2023 Sep; 71:103156.
Application:IF, Human, iPSC cells.
-
Generation of an induced pluripotent stem cell line (NCHi010-A) from a 6-year-old female with down syndrome and without congenital heart disease.
Yang Yu, Matthew Alonzo, Shiqiao Ye, Anne Fang, Kandamurugu Manickam, Vidu Garg, Ming-Tao Zhao.
Stem Cell Research 2023 Sep; 71:103155.
Application:IF, Human, iPSC cells.
-
Establishment of NCHi009-A, an iPSC line from a patient with hypoplastic left heart syndrome (HLHS) carrying a heterozygous NOTCH1 mutation.
Subhodip Adhicary, Shiqiao Ye, Hui Lin, Karen Texter, Vidu Garg, Ming-Tao Zhao.
Stem Cell Research 2023 Feb; 66:103013.
Application:IF, Human, iPS cells.
-
Generation of an induced pluripotent stem cell line NCHi003-A from a 11-year-old male with pulmonary atresia with intact ventricular septum (PA-IVS).
Javier Contreras, Matthew Alonzo, Shiqiao Ye, Hui Lin, Lumariz Hernandez-Rosario, Kim L McBride, Karen Texter, Vidu Garg, Ming-Tao Zhao.
Stem Cell Research 2022 Oct; 64:102893.
Application:IF, Human, NCHi003-A cells (Differentiated from peripheral blood mononuclear cells).
-
Characterization of an iPSC line NCHi006-A from a patient with hypoplastic left heart syndrome (HLHS).
Matthew Alonzo, Javier Contreras, Shiqiao Ye, Hui Lin, Lumariz Hernandez-Rosario, Kim L McBride, Karen Texter, Vidu Garg, Ming-Tao Zhao.
Stem Cell Research 2022 Aug; 64:102892.
Application:IF, Human, iPSC-derived endoderm.
-
Spotting-based differentiation of functional dopaminergic progenitors from human pluripotent stem cells.
Jisun Kim, Jeha Jeon, Bin Song, Nayeon Lee, Sanghyeok Ko, Young Cha, Pierre Leblanc, Hyemyung Seo, Kwang-Soo Kim.
Nature Protocols 2022 Mar; 17(3):890.
Application:IF, Human, Human midbrain dopamine progenitors (H9 cells).
-
Generation and characterization of a human induced pluripotent stem cell line heterozygous for a NOTCH1 mutation (NCHi014-A).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com