FOXA1 monoclonal antibody (M02J), clone 1B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXA1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXA1 monoclonal antibody (M02J), clone 1B1. Western Blot analysis of FOXA1 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody (M02J), clone 1B1.
Lane 1: FOXA1 transfected lysate (Predicted MW: 49.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA1 is 0.3 ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA1 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXA1 on HepG2 cell . [antibody concentration 10 ug/ml] -
Gene Info — FOXA1
Entrez GeneID
3169GeneBank Accession#
NM_004496Protein Accession#
NP_004487Gene Name
FOXA1
Gene Alias
HNF3A, MGC33105, TCF3A
Gene Description
forkhead box A1
Omim ID
602294Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq
Other Designations
hepatocyte nuclear factor 3, alpha
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com