Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HMX2 monoclonal antibody (M07A), clone 1B10

  • Catalog # : H00003167-M07A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant HMX2.
  • Immunogen:
  • HMX2 (NP_005510, 125 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003167-M07A
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3167
  • Gene Name:
  • HMX2
  • Gene Alias:
  • H6L,Nkx5-2
  • Gene Description:
  • H6 family homeobox 2
  • Other Designations:
  • H6 homeo box 2,OTTHUMP00000020683,homeo box (H6 family) 2,homeobox (H6 family) 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook